<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1021 1021-40701 U.S. 2004 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 67

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82T, I84V K43T L10I, K20R, L24M, E35D, M36I, I62V, L63P, I64V, A71V  
>1021-40701| codons 1-99
PQITLWQRPIVTIKIGGQLREALMDTGADDTVLEDINLPGRWTPKMIGGIGGFVKVRQYD
QVPVEICGHKVIGTVLVGPTPTNVIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103KNRS A98G E28EK, K43X, E44ED, K101KR, V118VI, K122E, I142V, S162SN, T165TI, T200A, R211K, L228H, A272P, I293V, E297Q, D324DE, I329L, E370D, A376S, T377L, T386I, K390R  
>1021-40701| codons 1-399
PISPIETVPVKLKPGMDGPKVKQWPLTKEKIKALVEICTELEXDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLRKSKSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQNSMIKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVVPLTQEAE
LELAENREILKEPVHGVYYDPSKELIAELQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTDAVQKISLESIVIWGKIPKFRLPIQKETWE

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006