<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1021 1021-30317 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LI, M184V, L210W, T215Y     A98G K43X, E44ED, S68SG, V118VI, K122E, D123DN, I142V, K173KE, T200A, R211K, L228H  
>1021-30317| codons 38-247
CTELEXDGKISKIGPENPYNTPVFAIKKKDGTKWRKIVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFREQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A L24I, K43KPQT Q7R, L10I, K20R, E35D, M36I, I62V, L63P, I64V  
>1021-30317| codons 4-99
TLWRRPIVTIKIGGQLREALIDTGADDTVLEDINLPGRWTPKMIGGIGGFVKVRQYDQVP
VEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006