<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1584 1584-30723 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75VIM, L210LW, T215Y   K101E, G190GS   T39A, K43KE, V60I, K122E, E138EG, I142V  
>1584-30723| codons 38-247
CAELEEEGKISKIGPENPYNTPIFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNGTPGVRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVSSDLEIGQHRTKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F, L33LI, L89V T12Q, I13V, Q18H, L19IT, K20M, M36IT, P39PA, I62V, L63P, A71T, I72T  
>1584-30723| codons 4-99
TLWQRPFVQVKIGGHTMEALLDTGADDTVIEETNLAGRWKPKIIGGIGGFVKVRQYDQVP
IEICGHKTTGTVLVGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006