<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2237 2237-30715 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y V75T, K219E L100I, K103N   T69N, K122E, I135M, T200A, I202IV, E203D, L228H  
>2237-30715| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKNSNKWRKVTDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKVDELRQHLWRWGFYTP
DEKHQKEPPFHWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82F, L90M L23I, L33F, K43T L10I, I13V, E35D, M36I, N37NS, I62V, L63P, I64V, A71AV, I93L  
>2237-30715| codons 4-99
TLWQRPIVTVKIGGQLKEAILDTGADDTVFEDISLPGRWTPKIIGGIGGFVKVRQYDQVP
VEICGHKVIGTVVVGPTPFNIIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006