<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2088 2088-30709 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73T I13M, I15V, Q18QH, K20I, E35D, M36I, N37PS, K55KR, I62V, L63P, I64V, I66V, K70KE  
>2088-30709| codons 4-99
TLWQRPFVTMKVGGHLIEALLDTGADDTVLEDISLPGRWKPKIIGGIGGFVRVRQYDQVP
VEVCGHEAITTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, M184V, L210W, T215Y V75M K103N   K43Q, K49R, V60I, V118I, K122E, D123N, S162D, K166R, G196E  
>2088-30709| codons 38-247
CTELEQEGKISRIGPENPYNTPIFAIKKKNSDKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006