<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2086 2086-30624 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V   L10I, T12P, I13V, K14R, D60E, I62V, L63P, A71T, I72V, P79S, V82I, Q92R, I93L  
>2086-30624| codons 4-99
TLWQRPIVPVRIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVRQYEQVP
IEICGHKTVGTVLVGSTPINVIGRNLLTRLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, L210W, T215Y K219N Y181C   T39A, K43E, E44D, V60I, K101Q, V118I, K122E, I135M, V179VI, V245E  
>2086-30624| codons 38-247
CAELEEDGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLQKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSMNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIIICQYMDDLYVGSDLEIGQHRTKIEELRQHLWRWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006