<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2085 2085-30610 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, I84V, L90M V11I, L33F, F53L, G73T L10I, I13V, I62V, L63P, A71V, I72V  
>2085-30610| codons 4-99
TLWQRPIITVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKIIGGIGGLLKVRQYDQVP
IEICGHKVVTTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, L74LI, M184V, L210W, T215F K219Q     E40F, K43N, K122E, D123DN, S162SN, K166R, G196E, H208Y, R211RK, D218E, L228H, V245M  
>2085-30610| codons 38-247
CTFLENEGKISKIGPENPYNTPVFAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQNSMTRILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRTKIEELRQYLWKWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006