<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2006 2006-30604 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L24I, L33F Q7E, L10I, T12K, I13IV, L19I, K20T, K43KI, L63P, I64IV, A71V, T91S, Q92R  
>2006-30604| codons 4-99
TLWERPIVKVKIGGQITEALIDTGADDTVFEEMNLPGRWIPKIIGGIGGFVKVRQYDQIP
VEICGHKVIGTVLVGPTPTNVIGRNLLSRIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y   K103N A98GS T39K, K43E, E44D, V60I, K101KQ, V118I, K122E, D123E, I135T, Q174QR, G196E, I202V  
>2006-30604| codons 38-247
CKELEEDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLQKNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVIYQYVDDLYVGSDLEIEQHRTKVEELRQHLWRWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006