<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1017 1017-30507 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M V11I, G73S L10I, I15V, K20I, N37C, R41K, K45KR, I62V, L63P, C67F, H69HQ, A71I, I72K, P79PA, I85IV, I93L  
>1017-30507| codons 4-99
TLWQRPIITIKVGGQLIEALLDTGADDTVLEEMCLPGKWKPRIIGGIGGFVKVRQYDQVP
IEIFGQKIKSTVLVGATPVNVVGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219R Y188YH   T39TA, E44D, V118I, K122E, I178IM, T200TA, E203K, Q207E, H208Y, R211K, K223E, E224EK  
>1017-30507| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDMVIYQYIDDLHVGSDLEIGQHRAKIKELREYLWKWGFYTP
DRKHQEKPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006