<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1016 1016-30428 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48M, I54S, V82A, L90LM L33F L10I, G16A, L19LV, E34Q, N37D, Q61K, I62V, L63P, A71I, T74S, V77I, I93L Q92S
>1016-30428| codons 4-99
TLWQRPIVTIKIAGQVKEALLDTGADDTVFQEMDLPGRWKPKLIMGIGGFSKVRQYDKVP
IEICGHKIIGSVLIGPTPANIIGRNLMTSLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, V75T, M184V, L210W, T215Y K219R L100I, K103N   T39A, E44D, E79ED, R83K, V118I, K122E, S162D, V179T, V189VI, Q207E, R211K, D218E  
>1016-30428| codons 38-247
CAELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKVTDFRDLNKKTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDITIYQYVDDLYIGSDLEIGQHRTKIEELREHLWKWGFYTP
ERKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006