<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2125 2125-30812 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I84V L10F, L33F, Q58E, L89LV I13V, K20R, E35D, M36L, I62V, L63P, V77VI, N83S  
>2125-30812| codons 4-99
TLWQRPFVTVKIGGQLREALLDTGADDTIFEDLNLPGRWKPKIIGGIGGFIKVREYDQVP
IEICGHKAIGTVLIGPTPVSVIGRNVLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, L210LW, T215Y       A98S, D123E, F171Y, I178IM, Q197E, T200A, R211RK, V245Q  
>2125-30812| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
SGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPYRKQNPDMVIYQYVDDLYVGSDLEIGEHRAKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIQLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006