<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1311 1311-30530 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F I13V, K14R, I15V, K20I, R41K, L63P, I64V, A71V, T74S, P79A, T91S, I93L  
>1311-30530| codons 4-99
TLWQRPFVTVRVGGQLIEALLDTGADDTVLEEMNLPGKWKPKIIGGIGGFVKVRQYDQIP
VEICGHKVIGSVLVGATPVNVIGRNLMSQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q K103N A98G T39A, V60I, T69N, D121H, K122E, I135L, S162D, V179I, R211K, D218E  
>1311-30530| codons 38-247
CAELEKEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLHEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIIIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006