<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1310 1310-30516 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32VI, M46MI, I47IV, I54IL, I84V, L90M L33LF, G73GS, T74TPS L10I, I13IV, E34EQ, I62IV, L63P, A71AV, I72IMV, V77I, I93L  
>1310-30516| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTIFQEMNLPGRWKPKIVGGIGGFLKVRQYDQVP
IEICGHKVVSSVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41LS, L74LV, M184V, L210LW, T215Y   K101KPQT A98AG, V108VI K43KQ, S68SG, V118VI, K122KE, T165TI, Q174R, Q207DE, H208HY, R211K, L228LH, V245K  
>1310-30516| codons 38-247
CTESEQEGKISKIGPENPYNTPVFAIKKKDGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
GGLTKKKSVTILDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKRNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELREYLWKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006