<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2399 2399-30818 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, I84V, L90M L10FY I15V, G16A, K20V, E34Q, L63Q, I64V, H69Q, T74S, V77I, I85V, L89I, T91S, Q92K  
>2399-30818| codons 4-99
TLWQRPYVTIKVAGQLVEALLDTGADDTILQEMNLPGRWKPKIVGGIGGFLKVRQYDQIQ
VEICGQKAIGSVLIGPTPVNVVGRNIMSKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, L74I, T215F K219E K103KN, Y181C, G190AST   T69N, K101KT, D123E, D177E, G196E, T200A, L228R  
>2399-30818| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSNRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLTKNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYMDDLYVTSDLEIEQHRAKIEELRQHLLRWGFFTP
DEKHQKEPPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006