<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2396 2396-30804 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54L, L76V, I84V, L90M L10F, G73S, L89V I13V, I15V, K20I, L33L_L, M36I, I62V, L63P, A71I, I72R, T91S  
>2396-30804| codons 4-99
TLWQRPFVTVKVGGQLIEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFLKVRQYDQVP
IEICGHKIRSTVVVGPTPVNVIGRNVMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215F K219Q L100I, K103N K238T V60I, K122E, D177E, I178M, V179I, T200A, D218E, E224D N137NS
>2396-30804| codons 38-247
CTELEKEGKISKIGPENPYNTPIFAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINSETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEMIIYQYVDDLYVGSDLEIGQHRAKIEELRQHLWRWGFFTP
EQKHQKDPPFLWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006