<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1011 1011-30624 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84V, L90M L10LF, G73T I13IM, K20I, L63P, I64V, K70R, A71V, I85IV P79ADNT
>1011-30624| codons 4-99
TLWQRPFVTMKIGGQLIEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFVKVRQYDQIP
VEICGHRVITTVLVGTTPVNVVGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184MV, L210L*W, T215Y   K103KN   K43KE, K122E, I135IT, S162C, T200A, Q207E, R211K  
>1011-30624| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006