<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1304 1304-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46ML, I54L, L90M L10F, L33F, Q58E, N88D I13IV, G16GA, E35ED, N37S, I62V, L63P, I72IM, V77VI, I93L  
>1304-30717| codons 4-99
TLWQRPFVTVKIAGQLKEALLDTGADNTVFEDMSLPGRWKPKLIGGIGGFLKVREYDQVP
IEICGHKAMGTVLIGPTPVNIIGRDLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q K103N   V60I, K122E, I135T, S162Y, K173KQ, Q207DE, R211RK, F214L, L228H  
>1304-30717| codons 38-247
CTEMEKEGKISKIGPENPYNTPIFAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRQQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELREHLLKWGLTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006