<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1305 1305-30717 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47IV, I54V, V82VA L33LF L10I, K14R, K20KT, R41K, L63P, A71AV, I72V  
>1305-30717| codons 4-99
TLWQRPIVTIRIGGQLTEALLDTGADDTIFEEMNLPGKWKPKIVGGIGGFVKVRQYDQIP
IEICGHKVVGTVLVGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74LV, M184V, L210W, T215Y D67G, K219N L100LI, K103N   K43E, E44EAD, S68G, K102R, V118VI, K122KE, D123E, I135T, S162SN, D177E, G196E, Q197K, E203A, R211RK  
>1305-30717| codons 38-247
CTELEEDGKISKIGPENPYNTPVFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGIKRNKSVTVLDVGDAYFSIPLDEEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIEKHRTKIAELRQHLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006