<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1303 1303-30711 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48GV, I54M, V82A, L90M   L10I, R41K, I62V, L63P, A71T, T74S, V77I, I93L  
>1303-30711| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGKWKPKMIVGIGGFMKVRQYDQVP
IEICGHKTIGSVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, M184V, T215F K219Q Y188L A98G K43Q, V60I, T69N, V106I, L109LIM, D123E, I135V, S162SDGN, Q174H, D177E, V179VI, G196E, H208Y, R211K, W212WC, D218E, V245E  
>1303-30711| codons 38-247
CTELEQEGKISKIGPENPYNTPIFAIKKKNSNRWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSITVMDVGDAYFSVPLDKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQNSMTKILEPFRKHNPEIIIYQYVDDLLVGSDLEIEQHRTKIEELRQYLLKCGFFTP
EQKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006