<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1302 1302-30711 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, Q58E, G73S, L89V I13V, K20T, L33V, K55R, D60E, Q61DE, I64V, T91TS  
>1302-30711| codons 4-99
TLWQRPFVTVKIGGQLTEALLDTGADDTVVEEMNLPGRWKPKIIGGIGGFVRVREYEEIL
VEICGHKAISTVLVGPTPVNVIGRNVMSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, T69TADN, L210W, T215Y K219R K103KN   K43E, V118I, G196E, T200A, Q207E, H208Y, R211K, L228H, V245E  
>1302-30711| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIEQHRAKIEELREYLWKWGFYTP
DRKHQKEPPFHWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006