<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1771 1771-30529 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I47V, L90M   L10I, I13V, E35D, M36I, N37D, L63P, I72V, V82VI, Q92QK  
>1771-30529| codons 4-99
TLWQRPIVTVKIGGQLKEALLDTGADDTILEDIDLPGRWKPKMVGGIGGFIKVRQYDQIP
IEICGHKAVGTVLVGPTPINIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215Y V75AS, K219E G190Q V179D E44D, V60VI, V118I, K122E, H208Y, L210Y, R211K, D218E, L228H  
>1771-30529| codons 38-247
CTELEKDGKISKIGPENPYNTPIFAIKKKNSTRWRKISDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIDIYQYVDDLYVQSDLEIGQHRTKIEELRQYLYKWGFYTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006