<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1769 1769-30430 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54A, V82A, L90M L33F, K43KT L10I, E35ED, M36L, N37D, R57RK, I62V, L63P, A71I, I72V, Q92QK, I93L  
>1769-30430| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVFEDLDLPGRWTPKMIMGIGGFAKVKQYDQVP
IEICGHKIVGTVLVGPTPANIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y K219N Y181C, G190A V108I E44D, V111I, V118I, D123E, D177E, H208Y, R211K, W212C, D218E  
>1769-30430| codons 38-247
CTELEKDGKISKIGPENPYNTPVFAIKKKNSTKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTILDIGDAYFSIPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIVICQYVDDLYVASDLEIGQHRTKIEELRQYLWKCGFYTP
ENKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006