<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1644 1644-30312 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M Q58E L10I, L63P, K70Q, A71V, V77I, I93L  
>1644-30312| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIVGIGGFVKVREYDQIP
IEICGHQVIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, V75M, T215F K219Q K103N, Y181C   T39E, V60I, K122E, I135T, S162Y, D177E, V179I, E203D, Q207E, D218E, L228H  
>1644-30312| codons 38-247
CEELEKEGKISKIGPENPYNTPIFAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIIICQYMDDLYVGSDLEIGQHRTKIDELREHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006