<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1005 1005-30304 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54L, V82T, I84V, L90M L33F, G73S L10I, V11L, I13V, E34Q, N37S, K55R, R57RK, L63P, A71V, I93L  
>1005-30304| codons 4-99
TLWQRPILTVKIGGQLKEALLDTGADDTVFQEMSLPGRWKPKIIGGIGGFLRVKQYDQIP
IEICGHKVISTVLVGPTPTNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, T215Y       T39A, K43E, K122E, D177E, V179VI, I195L, Q207N, H208HY, R211K, L228H  
>1005-30304| codons 38-247
CAELEEEGKISKIGPENPYNTPVFAIKKKDSTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEIIIYQYVDDLYVGSDLELGQHRTKIEELRNYLLKWGFYTP
DKKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006