<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1003 1003-30303 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, V82F, I84V, L90M Q58E L10I, I13V, I15V, K20I, E35D, M36I, N37D, L63P, L89I D25DH
>1003-30303| codons 4-99
TLWQRPIVTVKVGGQLIEALLHTGADDTVLEDIDLPGRWKPKIIGGIGGFIKVREYDQIP
IEICGHKAIGTVLVGPTPFNVIGRNIMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184I, L210W, T215Y K219N K103N, Y181C, G190A K101H K43X, E44D, V60I, V118I, K122E, A158T, K166KR, G196E, T200TA, I202V, E203A, H208Y, R211K  
>1003-30303| codons 38-247
CTELENDGKISKIGPENPYNTPIFAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
TIFQSSMTRILEPFRKQNPDIVICQYIDDLYVASDLEIEQHRAKVAELRQYLWKWGFYTP
DNKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006