<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2414 2414-30821 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, L74I, M184V, T215F K219Q L100I, K103N   T39A, K122E, Q174QR, D177EG, T200A, Q207E, D218E, L228H, V245K  
>2414-30821| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGIKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPGIVIYQYVDDLYVGSDLEIGQHRAKIEELREHLLRWGFFTP
EQKHQKEPPFHWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46IL, I54V, V82CST, L90M L33F, G73S L10I, I15V, G16A, K20R, E35D, M36I, N37DE, K55KR, R57K, Q61E, I62V, L63P, A71I, I72IT, I85V, I93L  
>2414-30821| codons 4-99
TLWQRPIVTIKVAGQLREALLDTGADDTVFEDIELPGRWKPKLIGGIGGFVRVKQYDEVP
IEICGHKITSTVLVGPTPTNIVGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006