<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-2413 2413-30815 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54V, V82A, L90M V11I, G73S L10I, T12P, I13V, I15V, K20I, M36I, N37S, I62V, L63P, C67CY, G68E, A71V, I72L  
>2413-30815| codons 4-99
TLWQRPIIPVKVGGQLIEALLDTGADDTVLEEISLPGRWKPKMIVGIGGFVKVRQYDQVP
IEIYEHKVLSTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_VG, V75M, M184V   K103N V108I, K238T K46Q, K64R, S117T, V118I, K122E, I135T, V189VI, F214L, H221Y, L228R  
>2413-30815| codons 38-247
CTEMEKEGQISKIGPENPYNTPVFAIRKKDSSKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTILDVGDAYFTIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVIYQYVDDLYIGSDLEIGQHRTKIEELRQHLLRWGLTTP
DKKYQKEPPFRWMGYELHPDTWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006