<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-1477 1477-30725 U.S. 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, I54V, V82S, I84V K43T L10I, I15V, K20R, E35D, M36I, R41K, I62V, L63P, I64V, A71AITV, T74S, I85IV, I93L  
>1477-30725| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTVLEDINLPGKWTPKLIVGIGGFVKVRQYDQVP
VEICGHKVIGSVLVGPTPSNVVGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006