<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4016 4016-30723 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, I84V, L90M V11I, G73S L10I, I15V, L19P, K20V, A22V, M36MI, K55KR, D60E, I62V, L63P, A71T, I72T, I85V, Q92QK  
>4016-30723| codons 4-99
TLWQRPIITIKVGGQPVEVLLDTGADDTVLEEINLPGRWKPKLIGGIGGFVRVRQYEQVP
IEICGHKTTSTVLVGPTPVNVVGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70G, L74V   K103N, Y181C   S68N, T69A, K122E, I135L, Q174R, D192DE, R211K, V245E  
>4016-30723| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDNAGWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIVICQYMDDLYVGSELEIGQHRTKIEELRQHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006