<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4021 4021-30514 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, Y115YF T215TI, K219E K101DE, Y181C, G190A V108I, V179D T39TA, S68G, K122E, Q174R, G196K, F214FL, V245K  
>4021-30514| codons 38-247
CAEMEKEGKISKIGPENPYNTPVFAIKRKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLEKKKSVTILDVGDAFFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPDIDICQYMDDLYVASDLEIKQHRTKIEELRQHLLRWGLITP
DEKHQKEPPFLWMGYELHPDKWTVQPIKLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54L, L90M L10F, G73T I13V, I15V, K20T, M36I, F53Y, K55N, Q61H, L63P, I64V, A71V  
>4021-30514| codons 4-99
TLWQRPFVTVKVGGQLTEALLDTGADDTILEEINLPGRWKPKIVGGIGGYLNVRQYDHIP
VEICGHKVITTVLVGPTPVNIIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006