<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4096 4096-30515 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R   K103KNRS, Y181YC A98AG, V179E T39TS, T69TN, D86E, V118VI, A158AS, S162SC, E169ED, T200TA, R211RK, F214L  
>4096-30515| codons 38-247
CSEMEKEGKISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRELNKRTQEFWEVQLGIPHP
GGLKKSKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQCSMTKILDPFRKQNPDIEICQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGLTTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, E35D, N37D, L63P, A71AITV, I72IV, V77VI, P79PS, I93L  
>4096-30515| codons 4-99
TLWQRPLVTIRIGGQLKEALLDTGADDTVLEDMDLPGRWKPKMIGGIGGFIKVRQYDQIP
IEICGHKVVGTVLIGSTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006