<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4084 4084-30331 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M V11VI L10Y, I15V, K20I, E21D, E35D, M36I, N37E, K55R, R57K, I62V, L63P, H69HQ, A71T, I72T, I93L, C95F  
>4084-30331| codons 4-99
TLWQRPYITIKVGGQLIDALLDTGADDTVLEDIELPGRWKPKIIGGIGGFIRVKQYDQVP
IEICGQKTTGTVLVGPTPVNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74V, M184V, T215F K219E K101E, Y181C, G190S   T39A, K49R, T69N, V90I, K122E, D123N, I135L, Q174R, D177E, G196E, R211K, D218E, L228H  
>4084-30331| codons 38-247
CAELEKEGKISRIGPENPYNTPVFAIKKKNSNRWRKVVDFRELNKRTQDFWEIQLGIPHP
AGLEKKKSVTVLDVGDAYFSVPLDENFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKRNPEIVICQYVDDLYVSSDLEIEQHRTKIEELRQHLLKWGFFTP
EEKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006