<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4080 4080-30225 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V L24I, F53L L10I, K20R, M36I, R41K, D60E, I62V, I64V, I66F, A71V, T91TS  
>4080-30225| codons 4-99
TLWQRPIVTIKIGGQLREALIDTGADDTVLEEINLPGKWKPKIIGGIGGLVKVRQYEQVL
VEFCGHKVIGTVLVGPTPTNVIGRNLLSQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, T215Y D67G, K219E Y181C, G190A K101H S68G, K122E, T165TI, E194K, Q197E, Q207E, R211K, D218E, L228R, V245K  
>4080-30225| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKGGTRWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIVICQYMDDLYVASDLKIGEHRTKIEELREHLLKWGFYTP
EEKHQKEPPFRWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006