<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4082 4082-30225 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y   K103N A98G T39A, K122E, I135IL, I142T, A158S, S162A, Q207E, R211K, L228HR  
>4082-30225| codons 38-247
CAELEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSLNNETPGTRYQYNVLPQGWKGSP
SIFQASMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, V82A, I84V, L90M V11I, L33F L10V, I13V, L63P, A71V, I93L  
>4082-30225| codons 4-99
TLWQRPVITVKIGGQLKEALLDTGADDTVFEEMNLPGRWKPKLIGGIGGFIKVRQYDQIP
IEICGHKVIGTVLVGPTPANVIGRNLMTQLGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006