<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4081 4081-30225 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T215FS   K103KN, Y181C   T69TN, R83K, D121Y, K122E, I135L, D177DG, I178L, E203D, L228LR  
>4081-30225| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKDSNKWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPGLVICQYMDDLYVGSDLEIGQHRTKIDELRQHLLRWGFSTP
DKKHQKEPPFRWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16GE, M36I, I62IV, L63LP  
>4081-30225| codons 4-99
TLWQRPLVTIKVEGQLKEALLDTGADDTVLEEINLPGRWKPKMIGGIGGFIKVRQYDQVP
IEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006