<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4079 4079-30224 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75VM, L210W, T215Y K219R     T39A, E44D, V60I, W88C, V90I, V118I, K122E, A158AS, S162H, T200A, Q207E E89EK
>4079-30224| codons 38-247
CAELEKDGKISKIGPENPYNTPIFAIKKKNSTKWRKLMDFRELNKRTQDFCKIQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
SIFQHSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRAKIEELREHLWRWGFYTP
DRKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M L33I, G73S L10I, V11L, I13V, K14R, A22V, E35D, M36I, N37D, I62V, L63P, A71V, I72V  
>4079-30224| codons 4-99
TLWQRPILTVRIGGQLKEVLLDTGADDTVIEDIDLPGRWKPKIIGGIGGFIKVRQYDQVP
IEICGHKVVSTVLVGPTPVNVIGRNLMTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006