<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4056 4056-30331 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I47V, G48V, I54M, V82A, L90M V32I_R L10I, L19I, R57RK, I62V, L63P, I64L, A71V, I72V, V77VI, Q92K  
>4056-30331| codons 4-99
TLWQRPIVTIKIGGQIKEALLDTGADDTILEEMNLPGRWKPKLVVGIGGFMKVKQYDQVP
LEICGHKVVGTVLIGPTPANIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74IV, M184V, L210W, T215Y   K103N   K43N, E44D, V118I, K122E, I142V, S162SAGT, G196E, T200I, I202IT, L228LR, Q242L  
>4056-30331| codons 38-247
CTELENDGKISKIGPENPYNTPVFAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSP
AIFQTSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIEQHRIKTEELRQHLWRWGFYTP
DKKHQKEPPFRWMGYELHPDKWTVLPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006