<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4013 4013-30203 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, G48V, I50V, I54S, V82A L33F, L89V L10V, I13V, Q18QH, K20R, E35D, M36L, N37D, L63P, A71V, I72M, I93L  
>4013-30203| codons 4-99
TLWQRPVVTVKIGGHLREALLDTGADDTVFEDLDLPGRWKPKIIVGVGGFSKVRQYDQIP
IEICGHKVMGTVLVGPTPANIIGRNVLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75S, K219N K101E, Y181C, G190A A98G, V108I E44D, K49R, K64R, R83K, I94L, V118I, D123E, D177DE, I178F, G196E, T200A, E203D, R211K, H221Y, V245K N137NI
>4013-30203| codons 38-247
CTELEKDGKISRIGPENPYNTPVFAIRKKNSTKWRKISDFRELNKKTQDFWEVQLGLPHP
GGLEKKKSVTILDVGDAYFSIPLDKEFRKYTAFTIPSINIETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPEFVICQYVDDLYVASDLEIEQHRAKIDELRQHLWKWGFYTP
DNKYQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006