<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4006 4006-30128 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y   K103N A98G S68G, K122P, K166R, D177E, T200A, R211RK  
>4006-30128| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
GGLKKNKSVTVLDVGDAYFSVPLDPDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTRILEPFRKQNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRQHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, G48V, I54V, V82T, I84V   L10I, I15V, K20R, M36I, L63P, I64M, A71V, I72V, Q92R  
>4006-30128| codons 4-99
TLWQRPIVTIKVGGQLREALLDTGADDTILEEINLPGRWKPKMIVGIGGFVKVRQYDQIP
MEICGHKVVGTVLVGPTPTNVIGRNLLTRIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006