<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4004 4004-30128 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, L76V, V82A L23I, F53L L10I, R41K, D60E, I62V, L63P, A71V, I93L  
>4004-30128| codons 4-99
TLWQRPIVTIKIGGQLKEAILDTGADDTVLEEMNLPGKWKPKIIGGIGGLVKVRQYEQVP
IEICGHKVIGTVVVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L210W, T215Y A62V, V75I K103N   T39A, E44ED, S68SG, A98AS, K101Q, V118VI, K122E, D123S, E138Q, I142T, S162ST, R172RK, I178L, Q207E, R211K  
>4004-30128| codons 38-247
CAELEKDGKISKIGPENPYNTPVFVIKKKNGTKWRKLIDFRELNKRTQDFWEVQLGIPHP
SGLQKNKSVTVLDVGDAYFSIPLDESFRKYTAFTIPSINNQTPGTRYQYNVLPQGWKGSP
AIFQTSMTKILEPFKKQNPDLVIYQYMDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006