<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4001 4001-30124 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, I84V, L90M L10F, G73S I13V, Q18H, K20I, M36I, L63P, A71V, I72L  
>4001-30124| codons 4-99
TLWQRPFVTVKIGGHLIEALLDTGADDTVLEEINLPGRWKPKIIGGIGGFVKVRQYDQIP
IEICGHKVLSTVLVGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74I, M184V, T215F K219Q Y181C, G190A K101H, V108I, P225PH K43N, K122E, S162D, V179VI, V189VI, Q197P, T200I, R211K, D218E  
>4001-30124| codons 38-247
CTELENEGKISKIGPENPYNTPVFAIKKKNSDKWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLHKKKSVTILDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQDSMTKILEPFRKQNPDIIICQYVDDLYIASDLEIGPHRIKIEELRQHLLKWGFFTP
EQKHQKEHPFLWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006