<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4002 4002-30124 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48MV, I54S, V82A, L90M L33F, K43T L10V, I13V, Q18QH, K20R, L24LF, E35D, M36I, N37D, I62V, L63P, A71I, I93L  
>4002-30124| codons 4-99
TLWQRPVVTVKIGGHLREALFDTGADDTVFEDIDLPGRWTPKMIVGIGGFSKVRQYDQVP
IEICGHKIIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, Y115YF, M184V D67G, T215TI, K219N V106M, G190GA V179D S68G, K103R, V118I, I135T, T165I, Q207E, R211RK, F214L, D237N  
>4002-30124| codons 38-247
CTELEKEGKISKIGPENPYNTPVFAIKKKGGTKWRKVVDFRELNKRTQDFWEVQLGIPHP
AGLKKRKSMTVLDVGDAFFSIPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMIKILEPFRKQNPDIDIYQYVDDLYVASDLEIGQHRTKIEELREHLLKWGLITP
DNKHQKEPPFLWMGYELHPNKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006