<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4051 4051-30822 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82A, L90M L10F, V11VI, L33I T12K, I13V, L19LP, K20M, E35D, M36I, N37D, I62V, L63P, I66F, A71T, I93L, C95F  
>4051-30822| codons 4-99
TLWQRPFIKVKIGGQPMEALLDTGADDTVIEDIDLPGRWKPKIIGGIGGFVKVRQYDQVP
IEFCGHKTIGTVLVGPTPANIIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70KR, L74V, M184V V75M, K219KQ Y181YC   K43E, K64H, T69N, V118I, K122E, I135T, T200A, F214L, L228H  
>4051-30822| codons 38-247
CTEMEEEGKISKIGPENPYNTPVFAIHKKDSNRWRKVMDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYVGSDLEIGQHRAKIEELRQHLLRWGLTTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006