<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4049 4049-30724 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I54A, V82T L24I, F53L L10I, K14R, N37ND, I62V, L63E, I64V, E65D, A71T, I72V, T74S, V77I, I93L  
>4049-30724| codons 4-99
TLWQRPIVTIRIGGQLKEALIDTGADDTVLEEMDLPGRWKPKMIMGIGGLAKVRQYDQVE
VDICGHKTVGSVLIGPTPTNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210W, T215Y D67G, K219R     T39K, K43E, E44D, V60I, V118I, S162SC, V179VI, H208Y, R211D, D218E, L228H, V245M T69Y
>4049-30724| codons 38-247
CKELEEDGKISKIGPENPYNTPIFAIKKKGSYKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIIIYQYMDDLYVGSDLEIGQHRTKIEELRQYLWDWGFYTP
ERKHQKEPPFHWMGYELHPDKWTVQPIMLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006