<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4048 4048-30714 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, L90M G73C L10R, I15V, L19P, K20I, E35G, M36L, N37T, P39S, K55R, Q61D, I62V, L63P, C67L, A71T, I72T, T74S, Q92K  
>4048-30714| codons 4-99
TLWQRPRVTIKVGGQPIEALLDTGADDTVLEGLTLSGRWKPKLIGGIGGFIRVRQYDDVP
IEILGHKTTCSVLVGPTPVNIIGRNLMTKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, V75M, M184V, L210W, T215Y D67E Y181YC, G190GA K101H T39D, K43KR, E44D, S68G, V118I, K122E, V189VI, Q207E, H208F, R211RK, V245E K103KI
>4048-30714| codons 38-247
CDELERDGKISKIGPENPYNTPVFAIKKKEGTKWRKLMDFRELNKRTQDFWEVQLGIPHP
AGLHKIKSVTVLDVGDAYFSIPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFRKQNPDIVICQYVDDLYIASDLEIGQHRTKIEELREFLWKWGFYTP
DKKHQKEPPFLWMGYELHPDKWTVQPIELP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006