<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4047 4047-30910 Australia 2003 HIV1 U Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA
2 NRTI+NNRTI+RTV+TPV 12

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, L74V, M184V, L210W, T215Y V75M, K219R G190A A98G, V108I, F227L T39A, K43E, E44D, V118I, K122E, D123DN, I135T, S162C, V189I, E203K, Q207E, H208Y, R211K, K223E, L228LH, D237E, V245M  
>4047-30910| codons 38-247
CAELEEDGKISKIGPENPYNTPVFAIKKKNSDKWRKVMDFRELNKRTQDFWEVQLGIPHP
GGLKKKKSVTILDVGDAYFSIPLDENFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSP
AIFQCSMTKILEPFRKQNPDIVIYQYVDDLYIASDLEIGQHRTKIKELREYLWKWGFYTP
DRKHQEEPPLHWMGYELHPEKWTVQPIMLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, M46I, I54V, V82A L24I, L33F, K43T, N88D L10I, I15V, E34V, E35D, M36L, I62V, L63P, A71T, I72T, V75I  
>4047-30910| codons 4-99
TLWQRPIVTIKVGGQLKEALIDTGADNTVFVDLNLPGRWTPKIIGGIGGFVKVRQYDQVP
IEICGHKTTGTILVGPTPANIIGRDLLTQIGCTLNF

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006