<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4045 4045-30331 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10F, L33LF, K43KT L19I, K20R, E35D, M36I, K55R, R57K, L63P, A71V, T91S, Q92QK, I93L, C95F  
>4045-30331| codons 4-99
TLWQRPFVTIKIGGQIREALLDTGADDTVFEDINLPGRWTPKLIGGIGGFVRVKQYDQIP
IEICGHKVIGTVLVGPTPANIIGRNLMSKLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V T215I, K219Q K103KN P225PH T39TK, K46KQ, T69N, R83K, V118I, S162Y, F214L, L228LR  
>4045-30331| codons 38-247
CKEMEKEGQISKIGPENPYNTPVFAIKKKDSNRWRKLVDFRELNKKTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAYFSIPLDKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPDIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLITP
DQKHQKEHPFRWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006