<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4044 4044-30306 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I47V, I54M, V82A, L90M G73S, L89V L10I, L33M, E34Q, N37T, L63P, A71V, I72V, I93L  
>4044-30306| codons 4-99
TLWQRPIVTIKIGGQLKEALLDTGADDTIMQEMTLPGRWKPKIVGGIGGFMKVRQYDQIP
IEICGHKVVSTVLVGPTPANIIGRNVMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69D, K70R, Q151M V75VI, F77L, F116Y, T215TAIV, K219Q G190A   D121DY, K122E, D123E, S162SDGN, R211I, V245T  
>4044-30306| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSDRWRKLIDLRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYYSVPLYEEFRKYTAFTIPSINNETPGIRYQYNVLPMGWKGSP
AIFQNSMTKILEPFRKQNPDIVIYQYMDDLYVASDLEIGQHRTKIEELRQHLLIWGFVTP
DQKHQKEPPFLWMGYELHPDKWTVQPITLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006