<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4031 4031-30219 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48V, I54ST, V82A K43T L10I, I15IV, L19T, K20R, E35D, M36I, D60E, I62IV, L63A, A71V, I93L  
>4031-30219| codons 4-99
TLWQRPIVTIKVGGQTREALLDTGADDTVLEDINLPGRWTPKMIVGIGGFTKVRQYEQVA
IEICGHKVIGTVLVGPTPANIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, L74I, M184V, T215F K219Q K103N   K43E, K102KR, D123E, S162Y, D177E, R211K, L228H  
>4031-30219| codons 38-247
CTELEEEGKISKIGPENPYNTPVFAIKKKNSTRWRKIVDFRELNKRTQDFWEVQLGIPHP
AGLKRNKSVTVLDVGDAYFSVPLDKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSP
AIFQYSMTKILEPFRKQNPEIVIYQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGFFTP
DQKHQKEPPFHWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006