<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
12-4060 4060-30716 Australia 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 PI|NRTI|NNRTI NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, I54V, L76V, V82A L33F, K43T, L89V L10V, I13V, K14R, K20M, M36I, K55R, L63P, A71V, T91A, Q92K  
>4060-30716| codons 4-99
TLWQRPVVTVRIGGQLMEALLDTGADDTIFEEINLPGRWTPKIIGGIGGFVRVRQYDQIP
IEICGHKVIGTVVVGPTPANIIGRNVLAKIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T69DE, K70R, L74V, V75T, Y115F, M184V, T215F K219Q K103N   V118I, K122E, I135V, K173E, T200A, E203D, F214L, L228LIV  
>4060-30716| codons 38-247
CTEMEKEGKISKIGPENPYNTPVFAIKKKNSERWRKVTDFRELNKRTQDFWEVQLGIPHP
AGLKKNKSVTVLDVGDAFFSIPLDEDFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQSSMTKILEPFREQNPDIVIYQYVDDLYVGSDLEIGQHRAKIDELRQHLLRWGLFTP
DQKHQKEPPFVWMGYELHPDKWTVQPIVLP

References
Author Title Citation
Baxter, JD Genotypic changes in human immunodeficiency virus type 1 protease associated with reduced susceptibility and virologic response to the protease inhibitor tipranavir. J Virol, 2006